Gene brarr_pan_p008654
| Sequence ID | brarr_pan_p008654 add to my list | ||
|---|---|---|---|
| Species | Brassica rapa subsp. rapa | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 132aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 132 amino acids
>brarr_pan_p008654_BRARR MADIEAMASRPRGTEIKEPAMQAMRLRTLMLCEELSLPSFQVIVVNADVGCDHCQDRVSK IVSKMTGIEEYVVDVKNKQVMARGDFKPRLVSHQQVKNVASQTLSHNAKRFFRPLNLFLR SIFSICLCPNTL
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP022701 | Unannotated cluster |
| 3 | GP047979 | Unannotated cluster |
| 4 | GP472665 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for brarr_pan_p008654
Represented sequence(s):
BRARR_Z1
BRARR_v3.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cm212920.1 | orthology | 1 | 5 | 77.8 | 1.8e-19 |
| Manes.02G038800.1 | orthology | 1 | 5 | 81.6 | 3.9e-21 |
| brana_pan_p001635 | orthology | 0.0175 | 2 | 219 | 3.71e-75 |
| braol_pan_p040844 | orthology | 0.0175 | 2 | 219 | 3.36e-75 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_01523.1 | orthology | 1 | 6 | 80.5 | 1.04e-20 |
| cicar_pan_p024775 | orthology | 1 | 5 | 79 | 3.48e-20 |
| cucsa_pan_p023048 | orthology | 1 | 5 | 64.3 | 1.12e-14 |
| maize_pan_p044279 | orthology | 0.633 | 2 | - | - |
| medtr_pan_p004416 | orthology | 1 | 5 | 77.8 | 1.38e-19 |
| phavu.G19833.gnm2.ann1.Phvul.003G219900.1 | orthology | 1 | 6 | 69.3 | 2.55e-16 |
| soybn_pan_p039239 | orthology | 1 | 5 | - | - |
| soybn_pan_p043513 | orthology | 1 | 5 | - | - |
| soybn_pan_p045249 | orthology | 1 | 5 | 75.9 | 1.01e-18 |