Gene brarr_pan_p044640


Sequence ID brarr_pan_p044640  add to my list
Species Brassica rapa subsp. rapa
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 105aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 105 amino acids

>brarr_pan_p044640_BRARR
MQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG
KKTSYWPVEAEAEPKSVAEPKAEVETKTEVKVDAKADAEPKLAEA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for brarr_pan_p044640



Represented sequence(s):
BRARR_Z1
BraA09t40375Z
Unrepresented genome(s):
BRARR_v3.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
brana_pan_p006052 orthology 0.0117 1 174 3.52e-58