Gene brarr_pan_p050124
Sequence ID | brarr_pan_p050124 add to my list |
---|---|
Species | Brassica rapa subsp. rapa |
Alias | No gene alias |
Pangenome status | Dispensable (1/2) |
Length | 78aa |
Length: 78 amino acids
>brarr_pan_p050124_BRARR KEEIDSLLRLPPHKIGVYTANIDVKQKKVTVVGNVEPWILIKKSVGRSEPNLNIFSNNLS SGCGDITCERILYCFSHL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.