Gene cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1


Sequence ID cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1  add to my list
Species Cajanus cajan
Alias No gene alias
Length 232aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 232 amino acids

>cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1_CAJCA
MHCEACARKVAKALKGFEGVEEVTADSKASKVVVKGKAADPIKVCERLQKKSGKKVELIS
PLPKPPEEKKDEEEIKEPQPEEKKEEPPPVVTVVLKVRMHCEACALVIQKQIRKIQGVES
VETSLGNDQVIVKGVVEPAKLVDYVYKRTKKQASIVKEEETEKKEQEEKKEEKEEEKKEG
EENKEDDVEDDDNKTDIKRSEYWPSRYYVDYIDYAYAPHIFSDENPNACTVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_14_162.1 orthology 0.565 7 213 6.09e-69
Ca_32_762.1 orthology 0.629 7 - -
Ca_69_1.19 orthology 0.629 7 - -
Ca_78_26.1 orthology 0.565 7 - -
Ca_9_645.2 orthology 0.624 6 - -
Cc09_g00430 orthology 0.624 7 182 6.17e-58
Cg2g046420.1 orthology 0.463 7 208.4 4.7e-54
Cm145580.1 orthology 0.68 6 - -
Cm298860.1 orthology 0.469 6 - -
Cs2g01750.1 orthology 0.463 7 208.4 5.1e-54
DCAR_002239 orthology 0.52 7 - -
DCAR_030843 orthology 0.562 7 - -
FvH4_3g00420.1 orthology 0.427 7 - -
HanXRQChr16g0515801 orthology 0.663 7 - -
MELO3C008010.2.1 orthology 0.57 6 - -
Manes.09G082500.1 orthology 0.617 6 - -
Manes.S022000.1 orthology 0.39 6 - -
Oeu029318.1 orthology 0.445 6 - -
Oeu057024.1 orthology 0.484 6 - -
PGSC0003DMP400023518 orthology 0.777 9 - -
PGSC0003DMP400026383 orthology 0.542 8 202.2 3.7e-52
Solyc04g015030.2.1 orthology 0.55 8 203 2.2e-52
Solyc11g012690.1.1 orthology 0.826 9 - -
capan_pan_p012494 orthology 0.679 7 - -
capan_pan_p018045 orthology 0.792 8 - -
cucsa_pan_p011686 orthology 0.559 6 - -
ipotf_pan_p000797 orthology 0.564 8 217 6.84e-71
itb01g10210.t2 orthology 0.57 8 216 2.97e-70
maldo_pan_p012376 orthology 0.44 7 256 3.58e-86
maldo_pan_p020510 orthology 0.449 7 - -
phavu.G19833.gnm2.ann1.Phvul.006G139700.1 orthology 0.137 1 235.3 3.8e-62
soybn_pan_p009673 orthology 0.135 2 - -
soybn_pan_p024238 orthology 0.116 2 296 6.77e-102
thecc_pan_p018912 orthology 0.358 6 - -
vitvi_pan_p012828 orthology 0.418 5 - -