Gene cajca.ICPL87119.gnm1.ann1.C.cajan_19470.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_19470.1 add to my list | ||
|---|---|---|---|
| Species | Cajanus cajan | ||
| Alias | No gene alias | ||
| Length | 152aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 152 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_19470.1_CAJCA MGVGEYWSDFMGSGNHQQYNIKNKKQFQTVELRVMMDCEGCELKVKKALSSLDGVKSVEI NRKQQKVTVTGYVEPNKVLKKAKSTKKKAEIWPYVPYNMVAHPYTVQAYDKRAPPGYVRR VDYFATVGTVTTYEDPYTTMFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_19470.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Oeu028401.1 | orthology | 0.394 | 2 | - | - |
| Oeu045782.1 | orthology | 0.396 | 2 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.001G250300.1 | orthology | 0.17 | 2 | 253.4 | 8.9e-68 |
| soybn_pan_p020347 | orthology | 0.194 | 2 | 233 | 9.22e-80 |
| soybn_pan_p028650 | orthology | 0.221 | 2 | - | - |