GreenPhyl v5 - Gene cajca.ICPL87119.gnm1.ann1.C.cajan

Gene cajca.ICPL87119.gnm1.ann1.C.cajan_21306.1

Sequence ID

cajca.ICPL87119.gnm1.ann1.C.cajan_21306.1 ^{add to my list}

Species

Cajanus cajan

Alias

No gene alias

Length

156aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Homolog Predictions

156 amino acids

>cajca.ICPL87119.gnm1.ann1.C.cajan_21306.1_CAJCA
MGALDHISELFDCSNTSSKLKKKRKQFQTVEVKVKMDCEGCERKVKKAVEGMKGVSQVEV
DRKASKVTVSGYVEPSKVVSRIAHRTAKRAELWPYVPYDVVAHPYAPGVYDKKAPSGYVR
NAEVDPRVSNLARASSAEVRYTTAFSDENPAACVLM

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP040065	Unannotated cluster
4	GP463617	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_21306.1

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
cicar_pan_p008262	orthology	0.151	3	274	2.12e-96
medtr_pan_p009659	orthology	0.19	3	272	1.77e-95
phavu.G19833.gnm2.ann1.Phvul.011G035900.1	orthology	0.0694	2	292	2.3e-79
soybn_pan_p021369	orthology	0.0888	2	288	1.18e-101
soybn_pan_p037610	orthology	0.183	2	-	-
thecc_pan_p004464	orthology	0.416	3	219	2.68e-74