Gene cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 add to my list | ||
|---|---|---|---|
| Species | Cajanus cajan | ||
| Alias | No gene alias | ||
| Length | 91aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 91 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1_CAJCA LQIVELKVEMVGIHEKRLRKCLSKLKGIEKVEVDGNSQKVVVTGYTHKNKILKAVRKAGL KAEFWSAQNELLNAYVGASYANLRFNNFNIF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.467 | 7 | - | - |
| Ca_3_262.11 | orthology | 0.467 | 7 | - | - |
| Ca_455_136.3 | orthology | 0.467 | 7 | - | - |
| Ca_68_16.11 | orthology | 0.49 | 7 | 122.9 | 2.9e-28 |
| Cc10_g00290 | orthology | 0.49 | 7 | 113.2 | 7.6e-26 |
| Cg3g025710.1 | orthology | 0.327 | 7 | 152.5 | 1.2e-37 |
| Cm122260.1 | orthology | 0.339 | 6 | 149.4 | 1.7e-36 |
| Cs3g27690.1 | orthology | 0.327 | 7 | 152.5 | 1.3e-37 |
| DCAR_023025 | orthology | 0.351 | 4 | - | - |
| HORVU7Hr1G051110.3 | orthology | 1 | 9 | 77.4 | 5.9e-15 |
| MELO3C017056.2.1 | orthology | 0.473 | 7 | - | - |
| Manes.05G127500.1 | orthology | 0.365 | 5 | 138.7 | 2.1e-33 |
| Manes.18G002200.1 | orthology | 0.379 | 5 | - | - |
| Mba08_g25790.1 | orthology | 0.698 | 7 | - | - |
| ORGLA08G0178600.1 | orthology | 0.795 | 8 | 107.8 | 3.8e-24 |
| Oeu013567.1 | orthology | 0.371 | 5 | 132.5 | 2.1e-31 |
| Sspon.06G0001840-1A | orthology | 1 | 7 | - | - |
| Sspon.06G0001840-2C | orthology | 0.814 | 7 | - | - |
| Sspon.06G0001840-3D | orthology | 0.824 | 7 | 102.1 | 6.1e-22 |
| XP_010932092.1 | orthology | 0.504 | 6 | - | - |
| XP_017697769.1 | orthology | 0.529 | 6 | - | - |
| XP_019707878.1 | orthology | 0.542 | 7 | - | - |
| bradi_pan_p007471 | orthology | 0.805 | 8 | 108 | 2.79e-32 |
| capan_pan_p037558 | orthology | 0.478 | 6 | 111 | 6.25e-34 |
| cocnu_pan_p024788 | orthology | 0.504 | 6 | - | - |
| cocnu_pan_p029661 | orthology | 0.568 | 7 | - | - |
| cucsa_pan_p017207 | orthology | 0.473 | 7 | - | - |
| maize_pan_p023740 | orthology | 0.797 | 7 | 100 | 2.24e-29 |
| maldo_pan_p020708 | orthology | 0.363 | 5 | 130 | 2.85e-41 |
| musac_pan_p036492 | orthology | 0.686 | 7 | - | - |
| orysa_pan_p046260 | orthology | 0.77 | 8 | 107 | 7.18e-32 |
| sorbi_pan_p020199 | orthology | 0.773 | 7 | 100 | 1.29e-29 |
| soybn_pan_p037728 | orthology | 0.239 | 1 | - | - |
| soybn_pan_p037999 | orthology | 0.28 | 1 | - | - |
| soybn_pan_p041984 | orthology | 0.249 | 1 | - | - |
| thecc_pan_p004256 | orthology | 0.375 | 6 | - | - |
| tritu_pan_p008810 | orthology | 0.81 | 9 | 105 | 3.44e-31 |
| vitvi_pan_p014910 | orthology | 0.289 | 4 | 144 | 6.4e-47 |
| vitvi_pan_p031077 | orthology | 0.289 | 4 | - | - |