Gene cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1 add to my list | ||
|---|---|---|---|
| Species | Cajanus cajan | ||
| Alias | No gene alias | ||
| Length | 166aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 166 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1_CAJCA MSLKSSDRKMRRGFMCHSQASTAVCMSTRDPRSVVVPRRLDRSVFLDDTRLINYAKYSKL VEPPRSNPVPKIKFRGQDQDQAIEPRELQKTLTNNNNVFQVVVMRVAIHCQGCAGKVKKH LSKMEGVTSFSIDVESKRVTVMGHISPVAVLESISKVKRAEFWTAC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_5g30890.1 | orthology | 0.689 | 6 | - | - |
| Oeu026170.2 | orthology | 0.771 | 4 | 111.7 | 6.9e-25 |
| cocnu_pan_p025689 | orthology | 0.598 | 5 | - | - |
| maldo_pan_p006499 | orthology | 0.881 | 6 | 112 | 1.98e-31 |
| phavu.G19833.gnm2.ann1.Phvul.002G207200.1 | orthology | 0.0644 | 1 | 294.7 | 3.8e-80 |
| soybn_pan_p025312 | orthology | 0.0932 | 2 | 284 | 1.27e-99 |