Gene cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1


Sequence ID cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1  add to my list
Species Cajanus cajan
Alias No gene alias
Length 100aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 100 amino acids

>cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1_CAJCA
MVMRINIDCTGCYRKVKRALLDMPELDSHLLEKKQTRVVVCGRFIPQDVAIKIKKKTNRR
VEILDIQDMSENNAEMENQKPMTNSWTLLATQNQMETCHA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv5_110870_wcqq.t1 orthology 1 7 105.9 1.4e-23
Bv5_110870_wcqq.t2 orthology 1 7 106 1.13e-31
CgUng002450.1 orthology 0.878 6 124.4 3.8e-29
Cm118330.1 orthology 0.876 5 120.9 7.1e-28
Cs7g26570.1 orthology 0.878 6 124.4 4.2e-29
FvH4_5g12320.1 orthology 1 5 114.4 4.1e-26
Manes.05G138100.1 orthology 0.647 2 107.5 5.8e-24
PGSC0003DMP400010112 orthology 0.739 2 117.9 4e-27
Solyc03g119630.2.1 orthology 0.779 3 118.2 3.1e-27
capan_pan_p000343 orthology 0.906 3 - -
cucsa_pan_p010693 orthology 1 7 115 8.39e-35
maldo_pan_p026714 orthology 1 5 118 8.07e-36
thecc_pan_p001600 orthology 0.88 6 130 3.47e-40
vitvi_pan_p014384 orthology 0.765 5 133 6.05e-41