Gene cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1 add to my list | ||
|---|---|---|---|
| Species | Cajanus cajan | ||
| Alias | No gene alias | ||
| Length | 278aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 278 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1_CAJCA MKRMDIFCASQASTAICLSMDQASCSSSNTILLGGRTIDRHNPIINDSTRRSTSSKSLTT PCSSSQSPINPKPYHELHKAKKNSSSKSATKGHDHKKKSTSEKLTEHVTNASKPNDAIVR RSWLMPPSDSITPLGSTRSLLSDTAIVDGSSDYVPNLALTTVNNKTSQVVHQDEAISVPK LPSSSYPKSGSSDQVVVLRVSLHCKGCEGKVRKHLSRMQGVTSFNIDFAAKKVTVIGDVT PLSVLASISKVKNAQLWPASASAVGSGTVETKKEVLSN
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_37472.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT2G37390.1 | orthology | 1 | 5 | - | - |
| AT3G53530.2 | orthology | 0.984 | 5 | - | - |
| MELO3C003095.2.1 | orthology | 0.864 | 5 | 191.4 | 6.4e-49 |
| brana_pan_p029929 | orthology | 1 | 7 | - | - |
| brana_pan_p030312 | orthology | 1 | 7 | - | - |
| brana_pan_p031480 | orthology | 1 | 6 | - | - |
| brana_pan_p036701 | orthology | 1 | 7 | - | - |
| brana_pan_p041953 | orthology | 1 | 6 | - | - |
| braol_pan_p003859 | orthology | 1 | 6 | - | - |
| braol_pan_p015324 | orthology | 1 | 6 | - | - |
| braol_pan_p021666 | orthology | 1 | 6 | 166 | 1.56e-49 |
| braol_pan_p031578 | orthology | 1 | 6 | - | - |
| brarr_pan_p002630 | orthology | 1 | 7 | - | - |
| brarr_pan_p008392 | orthology | 1 | 7 | - | - |
| brarr_pan_p026146 | orthology | 1 | 7 | - | - |
| brarr_pan_p039884 | orthology | 1 | 6 | - | - |
| cucsa_pan_p020833 | orthology | 0.884 | 5 | 185 | 1.46e-57 |
| phavu.G19833.gnm2.ann1.Phvul.L001741.1 | orthology | 0.174 | 1 | 356.7 | 1.4e-98 |
| soybn_pan_p025142 | orthology | 0.0982 | 2 | 436 | 3.45e-156 |