Gene cajca.ICPL87119.gnm1.ann1.C.cajan_44138.1
| Sequence ID | cajca.ICPL87119.gnm1.ann1.C.cajan_44138.1 add to my list | ||
|---|---|---|---|
| Species | Cajanus cajan | ||
| Alias | No gene alias | ||
| Length | 119aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 119 amino acids
>cajca.ICPL87119.gnm1.ann1.C.cajan_44138.1_CAJCA MSCQGCAGAVNRVLGKMEGVESFDIDLKEQKVTVKGNVQPDEVLQAVSKTGKKTAFWVDE APPENKPSETAPVASTENDNKSSEKSAPVASDNKLSESATVASAEPENKPAETAIETVA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP239638 | Unannotated cluster |
| 3 | GP341755 | Unannotated cluster |
| 4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cajca.ICPL87119.gnm1.ann1.C.cajan_44138.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| phavu.G19833.gnm2.ann1.Phvul.007G247500.1 | orthology | 0.164 | 2 | 143.3 | 1e-34 |
| soybn_pan_p032567 | orthology | 0.137 | 1 | 159 | 1.27e-51 |