Gene capan_pan_p000483
Sequence ID | capan_pan_p000483 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 150aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 150 amino acids
>capan_pan_p000483_CAPAN MGVSGTLEYLSEVLSSVKKSKKKKQIATVAIKIRMDCEGCARKVKNVLSGVKGAKSVDVD LKQQKATVTGFVEPKKVLKAAQSTGKKCEIWPYVPYSMVAHPYAAGVYDKKAPPNFVRAT TDPTVAHLDPVEEQYSLMFSDENPNACNIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p000483
Represented sequence(s):
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_51_149.3 | orthology | 0.368 | 5 | 220 | 1.25e-74 |
Ca_54_61.7 | orthology | 0.381 | 4 | - | - |
Cc00_g30010 | orthology | 0.368 | 5 | 220 | 4.21e-75 |
Oeu024561.1 | orthology | 0.309 | 3 | 239 | 2.54e-82 |
Oeu061475.1 | orthology | 0.341 | 3 | - | - |
PGSC0003DMP400016735 | orthology | 0.0555 | 2 | - | - |
PGSC0003DMP400016737 | orthology | 0.0487 | 2 | 285 | 6.46e-101 |
Solyc04g072700.2.1 | orthology | 0.0481 | 2 | 285 | 6.43e-101 |
ipotf_pan_p013731 | orthology | 0.208 | 3 | 251 | 3.54e-87 |
itb06g23970.t1 | orthology | 0.202 | 3 | 252 | 1.34e-87 |