Gene capan_pan_p000797
Sequence ID | capan_pan_p000797 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 138aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 138 amino acids
>capan_pan_p000797_CAPAN MRVHMDCQGCESKVRKALKKLHGVDNIDIDMNMQKVTVTGWADQKKVLKTVRKTGKRAEL WPYPYNPEYHNYMNHYYYDTFYSRPGTYFAPPSSYNYRVHGYNGHAHSSYAELPYNAIFD EQTRHMFSDDNVTGCSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p000797
Represented sequence(s):
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_23_1086.1 | orthology | 0.438 | 2 | - | - |
Ca_24_186.3 | orthology | 0.449 | 3 | 186 | 3.69e-61 |
Ca_42_221.2 | orthology | 0.449 | 4 | - | - |
Ca_66_295.2 | orthology | 0.449 | 4 | - | - |
Cc02_g14880 | orthology | 0.427 | 3 | 162 | 9.15e-53 |
Oeu043106.1 | orthology | 0.546 | 3 | 187 | 6.33e-62 |
PGSC0003DMP400018109 | orthology | 0.0723 | 2 | 169 | 1.08e-55 |
Solyc02g076880.2.1 | orthology | 0.0949 | 2 | 276 | 2.01e-97 |
ipotf_pan_p011098 | orthology | 0.475 | 5 | - | - |
itb10g02670.t1 | orthology | 0.449 | 5 | 186 | 5.71e-62 |