Gene capan_pan_p000900
Sequence ID | capan_pan_p000900 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 147aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 147 amino acids
>capan_pan_p000900_CAPAN MGVLEYIANFCTITTSTNNKKKSMQTVEIKVKMDCDGCERRVKNSVKHMKGVKSVEVIRK QSKVIVNGYVDPNRVLKRIKSTGKRAEFWPYVPYNVVYYPHAPQAYDKRAPAGMVKNVPQ ALLAPNATEEKFAYLFSDDNPSACSIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p000900
Represented sequence(s):
Unrepresented genome(s):
CAPAN_Zunla_1_v2.0
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
1. | 2. | 3. | |
---|---|---|---|
1. CA.PGAv.1.6.scaffold11.13 | 0.00 | 10.79 | 10.79 |
2. CA.PGAv.1.6.scaffold3888.1 | 10.79 | 0.00 | -0.00 |
3. Capana04g002139 | 10.79 | -0.00 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Oeu007436.2 | orthology | 0.476 | 3 | - | - |
Oeu054755.1 | orthology | 0.462 | 3 | - | - |
PGSC0003DMP400029185 | orthology | 0.142 | 2 | 246 | 3.78e-85 |
Solyc03g043640.2.1 | orthology | 0.0305 | 2 | 293 | 4.57e-104 |
ipotf_pan_p014279 | orthology | 0.366 | 3 | 231 | 1.11e-79 |
itb03g08540.t1 | orthology | 0.366 | 3 | 231 | 1.2e-79 |