Gene capan_pan_p004624
Sequence ID | capan_pan_p004624 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 99aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 99 amino acids
>capan_pan_p004624_CAPAN MSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSFWEEA APAPAEPEAKPVEEKPAETPTDPEPKPAEEKPAETVAAA
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p004624
Represented sequence(s):
CAPAN_Zunla_1_v2.0
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_453_87.10 | orthology | 0.231 | 3 | 122 | 4.38e-37 |
Cc00_g29460 | orthology | 0.257 | 3 | - | - |
Cc02_g09880 | orthology | 0.197 | 2 | 122 | 5.59e-38 |
PGSC0003DMP400033854 | orthology | 0.137 | 2 | 130 | 3.71e-41 |
Solyc11g007200.1.1 | orthology | 0.138 | 2 | 133 | 3.92e-42 |