Gene capan_pan_p010270
Sequence ID | capan_pan_p010270 add to my list |
---|---|
Species | Capsicum annuum |
Alias | No gene alias |
Pangenome status | Core (3/3) |
Length | 244aa |
Length: 244 amino acids
>capan_pan_p010270_CAPAN MKSIDLFCASPASTAICSSMDQRTMVRHGIRHQIDRKIDRLGDPRTPKIKTPIPCSSHQL PFDPKNYYHQKIQKSQDGKLRRKSSADVADLGGSSRYLLSDSTTPFIDFLSSSDNCISGD AKALVPSKPVRAKSTNERLMYRSSSTRSVESPVYKPSSTYSNDLCVYKSTRSCPREQVVE LRVSIHCKGVKSFNIDLASKKVTVIGDVTPLGVLTSISKVKSAQFWPSPTTSSSSSSSSF SSMV
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
CAPAN_Zunla_1_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_CM334_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_4_477.7 | orthology | 0.497 | 4 | - | - |
Ca_84_91.1 | orthology | 0.488 | 5 | 181 | 2.77e-55 |
Cc01_g12180 | orthology | 0.486 | 5 | 181 | 6.63e-56 |
Oeu040283.1 | orthology | 0.439 | 2 | - | - |
Oeu058521.1 | orthology | 0.373 | 2 | 201 | 7.14e-64 |
PGSC0003DMP400027269 | orthology | 0.085 | 2 | 373 | 2.38e-132 |
Solyc11g073020.1.1 | orthology | 0.0811 | 2 | 363 | 2.85e-128 |
ipotf_pan_p019321 | orthology | 0.774 | 5 | - | - |
ipotf_pan_p020149 | orthology | 0.653 | 5 | 199 | 1.23e-63 |
itb07g12040.t1 | orthology | 0.759 | 5 | - | - |
itb14g16600.t1 | orthology | 0.638 | 5 | 198 | 2.58e-63 |