Gene capan_pan_p017109
Sequence ID | capan_pan_p017109 add to my list |
---|---|
Species | Capsicum annuum |
Alias | No gene alias |
Pangenome status | Core (3/3) |
Length | 258aa |
Length: 258 amino acids
>capan_pan_p017109_CAPAN MMVEDELAMIDPENEDFDPETESEEDEEEQQVVKLAEPSKTAVYNRDGLLERLADISWPD DLDWTHRLNIDREEQEEVDVNDDLAREHSFYTQGLEGIRQAYANFHSTGEPFLRPSDYYA EMVKSDVHMEKVKSRLLAEKKRIEESEERRKARENKKLAKEVQAQKMKERTKQKKQEIES VKKWRKQRQQSGFDKEDASGLDLAFDGGDANKPFQRSNKKRLVCKVLKVTLSHHWNSGLQ LAKKKPEGNRQPPAIIGL
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for capan_pan_p017109
Represented sequence(s):
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G22660.1 | orthology | 0.684 | 4 | 179 | 1.64e-55 |
PGSC0003DMP400055292 | orthology | 0.204 | 2 | - | - |
PGSC0003DMP400055391 | orthology | 0.188 | 2 | 305 | 6.81e-105 |
Solyc01g006090.2.1 | orthology | 0.202 | 2 | - | - |
Solyc01g006170.2.1 | orthology | 0.186 | 1 | 302 | 1e-103 |
brana_pan_p006433 | orthology | 0.666 | 5 | - | - |
brana_pan_p007884 | orthology | 0.665 | 6 | - | - |
brana_pan_p012403 | orthology | 0.659 | 5 | 184 | 3.54e-57 |
brana_pan_p034179 | orthology | 0.647 | 5 | - | - |
braol_pan_p022657 | orthology | 0.645 | 5 | - | - |
braol_pan_p024061 | orthology | 0.707 | 6 | 176 | 7.07e-54 |
braol_pan_p030426 | orthology | 0.666 | 5 | - | - |
brarr_pan_p009571 | orthology | 0.648 | 5 | - | - |
brarr_pan_p026538 | orthology | 0.654 | 4 | 184 | 6e-57 |
brarr_pan_p031703 | orthology | 0.653 | 5 | - | - |
ipotf_pan_p017885 | orthology | 0.544 | 3 | 175 | 1.32e-53 |
ipotf_pan_p024335 | orthology | 0.819 | 2 | - | - |
ipotf_pan_p027028 | orthology | 0.587 | 2 | - | - |
itb11g17740.t1 | orthology | 0.537 | 2 | - | - |
itb12g07110.t1 | orthology | 0.542 | 3 | 175 | 1.42e-53 |