Gene capan_pan_p018045
Sequence ID | capan_pan_p018045 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 195aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 195 amino acids
>capan_pan_p018045_CAPAN MDYKTSKVVVIGKNVDPLKVCEMVQKKSGGKVELISHQQSTKEEEEIKKEEEPKEEKTHE PPREITVVLNVQMHCDACAQVLQKQISKIKGVECVTTDLEKNQVIIKGVNIDPEKLANDV YKRCGKQVSLLNNIITPIEEKKDSNTKEEEEEEEEEEIMENYNLAQKYNNNNMEYYANYS RQIFSDDNSHACSLM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p018045
Represented sequence(s):
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_Zunla_1_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_14_162.1 | orthology | 0.686 | 4 | - | - |
Ca_32_762.1 | orthology | 0.75 | 4 | - | - |
Ca_69_1.19 | orthology | 0.75 | 4 | - | - |
Ca_78_26.1 | orthology | 0.686 | 4 | - | - |
Ca_9_645.2 | orthology | 0.746 | 3 | - | - |
Cc09_g00430 | orthology | 0.745 | 4 | - | - |
Cg2g046420.1 | orthology | 0.817 | 10 | - | - |
Cm145580.1 | orthology | 1 | 9 | - | - |
Cm298860.1 | orthology | 0.823 | 9 | - | - |
Cs2g01750.1 | orthology | 0.817 | 10 | - | - |
DCAR_002239 | orthology | 0.693 | 6 | - | - |
DCAR_030843 | orthology | 0.735 | 6 | - | - |
FvH4_3g00420.1 | orthology | 0.781 | 10 | - | - |
HanXRQChr16g0515801 | orthology | 0.836 | 6 | - | - |
MELO3C008010.2.1 | orthology | 0.924 | 9 | - | - |
Manes.09G082500.1 | orthology | 0.971 | 9 | - | - |
Manes.S022000.1 | orthology | 0.744 | 9 | - | - |
Oeu029318.1 | orthology | 0.618 | 5 | - | - |
Oeu057024.1 | orthology | 0.657 | 5 | - | - |
PGSC0003DMP400023518 | orthology | 0.228 | 2 | 228 | 4.94e-76 |
Solyc11g012690.1.1 | orthology | 0.277 | 2 | 212 | 3.13e-70 |
cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.792 | 8 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.729 | 8 | - | - |
cicar_pan_p024449 | orthology | 0.749 | 7 | - | - |
cucsa_pan_p011686 | orthology | 0.912 | 9 | - | - |
ipotf_pan_p000797 | orthology | 0.514 | 3 | - | - |
itb01g10210.t2 | orthology | 0.52 | 3 | - | - |
maldo_pan_p012376 | orthology | 0.794 | 10 | - | - |
maldo_pan_p020510 | orthology | 0.803 | 10 | - | - |
medtr_pan_p010658 | orthology | 0.735 | 7 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.743 | 8 | - | - |
phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.78 | 8 | - | - |
soybn_pan_p008938 | orthology | 0.724 | 7 | - | - |
soybn_pan_p009673 | orthology | 0.756 | 7 | - | - |
soybn_pan_p024238 | orthology | 0.737 | 7 | - | - |
thecc_pan_p018912 | orthology | 0.712 | 9 | - | - |
vitvi_pan_p012828 | orthology | 0.772 | 8 | - | - |