Gene capan_pan_p018045
| Sequence ID | capan_pan_p018045 add to my list | ||
|---|---|---|---|
| Species | Capsicum annuum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 195aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 195 amino acids
>capan_pan_p018045_CAPAN MDYKTSKVVVIGKNVDPLKVCEMVQKKSGGKVELISHQQSTKEEEEIKKEEEPKEEKTHE PPREITVVLNVQMHCDACAQVLQKQISKIKGVECVTTDLEKNQVIIKGVNIDPEKLANDV YKRCGKQVSLLNNIITPIEEKKDSNTKEEEEEEEEEEIMENYNLAQKYNNNNMEYYANYS RQIFSDDNSHACSLM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p018045
Represented sequence(s):
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_Zunla_1_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.686 | 4 | - | - |
| Ca_32_762.1 | orthology | 0.75 | 4 | - | - |
| Ca_69_1.19 | orthology | 0.75 | 4 | - | - |
| Ca_78_26.1 | orthology | 0.686 | 4 | - | - |
| Ca_9_645.2 | orthology | 0.746 | 3 | - | - |
| Cc09_g00430 | orthology | 0.745 | 4 | - | - |
| Cg2g046420.1 | orthology | 0.817 | 10 | - | - |
| Cm145580.1 | orthology | 1 | 9 | - | - |
| Cm298860.1 | orthology | 0.823 | 9 | - | - |
| Cs2g01750.1 | orthology | 0.817 | 10 | - | - |
| DCAR_002239 | orthology | 0.693 | 6 | - | - |
| DCAR_030843 | orthology | 0.735 | 6 | - | - |
| FvH4_3g00420.1 | orthology | 0.781 | 10 | - | - |
| HanXRQChr16g0515801 | orthology | 0.836 | 6 | - | - |
| MELO3C008010.2.1 | orthology | 0.924 | 9 | - | - |
| Manes.09G082500.1 | orthology | 0.971 | 9 | - | - |
| Manes.S022000.1 | orthology | 0.744 | 9 | - | - |
| Oeu029318.1 | orthology | 0.618 | 5 | - | - |
| Oeu057024.1 | orthology | 0.657 | 5 | - | - |
| PGSC0003DMP400023518 | orthology | 0.228 | 2 | 228 | 4.94e-76 |
| Solyc11g012690.1.1 | orthology | 0.277 | 2 | 212 | 3.13e-70 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.792 | 8 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.729 | 8 | - | - |
| cicar_pan_p024449 | orthology | 0.749 | 7 | - | - |
| cucsa_pan_p011686 | orthology | 0.912 | 9 | - | - |
| ipotf_pan_p000797 | orthology | 0.514 | 3 | - | - |
| itb01g10210.t2 | orthology | 0.52 | 3 | - | - |
| maldo_pan_p012376 | orthology | 0.794 | 10 | - | - |
| maldo_pan_p020510 | orthology | 0.803 | 10 | - | - |
| medtr_pan_p010658 | orthology | 0.735 | 7 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.743 | 8 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.78 | 8 | - | - |
| soybn_pan_p008938 | orthology | 0.724 | 7 | - | - |
| soybn_pan_p009673 | orthology | 0.756 | 7 | - | - |
| soybn_pan_p024238 | orthology | 0.737 | 7 | - | - |
| thecc_pan_p018912 | orthology | 0.712 | 9 | - | - |
| vitvi_pan_p012828 | orthology | 0.772 | 8 | - | - |