Gene capan_pan_p026342
| Sequence ID | capan_pan_p026342 add to my list |
|---|---|
| Species | Capsicum annuum |
| Alias | No gene alias |
| Pangenome status | Dispensable (2/3) |
| Length | 130aa |
Length: 130 amino acids
>capan_pan_p026342_CAPAN MLFGPIKVTALRTEFSPYPGSNPRPLVKGGAASFTALQPMSVCMVMRVNLDCPSCCRKMR KIILRRKEIEMHLIEKQHNRVSIFGRFDPADTAIRIRKKMNRRVEILDVRLPENGDGQAE EMHHAPGGTD
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
Unrepresented genome(s):
CAPAN_CM334_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
CAPAN_Zunla_1_v2.0
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400019266 | orthology | 0.457 | 2 | 87 | 6.51e-24 |
| Solyc05g016190.2.1 | orthology | 0.504 | 2 | 90.5 | 3.17e-25 |
| ipotf_pan_p021199 | orthology | 0.987 | 3 | - | - |
| ipotf_pan_p028439 | orthology | 0.876 | 3 | 113 | 4.55e-34 |
| itb07g07960.t1 | orthology | 0.986 | 3 | 114 | 2.89e-34 |
| itb14g01920.t1 | orthology | 0.876 | 3 | - | - |