Gene capan_pan_p026596
Sequence ID | capan_pan_p026596 add to my list | ||
---|---|---|---|
Species | Capsicum annuum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (2/3) | ||
Length | 159aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 159 amino acids
>capan_pan_p026596_CAPAN MGFLDPLFELFEFHRGTSRRKLSKVRRNQLETVEIRVKMDCEGCKRRVRKSVEGMKGVTK VEVEPKKHRLIVTGYVDPDKVLRRVRHRTGKRAEFWPYVPYDLVDHPYVRGVYDKKAPAG YVRNVYDNPQAPSLARASSTEVNYITAFSDENPQACTIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463678 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for capan_pan_p026596
Represented sequence(s):
Unrepresented genome(s):
CAPAN_CM334_v2.0
CAPAN_Zunla_1_v2.0
CAPAN_Glabriusculum_Chiltepin_v2.0
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_84_43.1 | orthology | 0.512 | 4 | - | - |
Cc07_g11100 | orthology | 0.466 | 4 | 234 | 1.46e-80 |
HanXRQChr09g0256841 | orthology | 0.439 | 4 | 226 | 7.92e-77 |
PGSC0003DMP400006528 | orthology | 0.0936 | 1 | 298 | 1.68e-105 |
Solyc02g083550.1.1 | orthology | 0.117 | 2 | 290 | 1.32e-102 |