Gene cicar_pan_p002360
| Sequence ID | cicar_pan_p002360 add to my list | ||
|---|---|---|---|
| Species | Cicer arietinum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 256aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 256 amino acids
>cicar_pan_p002360_CICAR MQTPRITQIQVRVDCNGCVRKIKKALNGIHGIDDLHIDFDRQRLTIIGWADPEKVVKAIK KTRKTAIICSNIEPTSSSKPTKSKPKPKPIPPAQDETIQPIPQEASTAQETSFPEPMLEA TSSSSSPKPTWYNTKQQWQNKPETEGVEEVHMLYYHQPNYINTFSSGHNYVEHRDRTYHN GRVFLQDPTQQPLYNVTHSYNTYMPSSYVTEYECVRSLSWHTHYNHMEHYSGDYHDNNVN IGDMFSDDNPNACCIV
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cicar_pan_p002360
Represented sequence(s):
CICAR_CDC_Frontier_kabuli
CICAR_ICC_4958_desi
| 1. | 2. | 3. | |
|---|---|---|---|
| 1. cicar.CDCFrontier.gnm1.ann1.Ca_02982.1 | 0.00 | -0.00 | -0.00 |
| 2. cicar.ICC4958.gnm2.ann1.Ca_19531.1 | -0.00 | 0.00 | -0.00 |
| 3. cicar.ICC4958.gnm2.ann1.Ca_23451.1 | -0.00 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg9g002000.1 | orthology | 0.912 | 7 | 120 | 1.78e-32 |
| Cm229420.1 | orthology | 0.915 | 7 | 121 | 2.76e-32 |
| Cs9g03680.1 | orthology | 0.929 | 6 | 119 | 7.49e-32 |
| FvH4_4g18950.1 | orthology | 0.94 | 5 | 137 | 6.95e-39 |
| Manes.15G008800.1 | orthology | 0.942 | 6 | 175 | 1.31e-53 |
| maldo_pan_p004517 | orthology | 0.949 | 5 | 152 | 4.3e-44 |
| maldo_pan_p022412 | orthology | 0.968 | 5 | - | - |
| medtr_pan_p024125 | orthology | 0.304 | 1 | 320 | 3.61e-111 |
| thecc_pan_p016610 | orthology | 0.879 | 5 | 167 | 4.52e-50 |
| vitvi_pan_p020280 | orthology | 0.765 | 3 | 154 | 1.26e-45 |