Gene cicar_pan_p006875


Sequence ID cicar_pan_p006875  add to my list
Species Cicer arietinum
Alias No gene alias
Pangenome status Core (2/2)
Length 72aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 72 amino acids

>cicar_pan_p006875_CICAR
MANVVEVKVGLHCDECIKKILKAIKKIEDIETYNVDKQLSKVIVTGNVTTEEVIGVLHKI
GKNATAWENVQC


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cicar_pan_p006875



Represented sequence(s):
CICAR_CDC_Frontier_kabuli
cicar.CDCFrontier.gnm1.ann1.Ca_12434.1
CICAR_ICC_4958_desi
cicar.ICC4958.gnm2.ann1.Ca_03499.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
MELO3C019982.2.1 orthology 0.637 5 106 1.67e-32
Manes.07G136400.1 orthology 0.443 4 116 2.26e-36
cucsa_pan_p000399 orthology 0.604 5 104 9.09e-32
medtr_pan_p025150 orthology 0.0549 1 137 2.1e-44
phavu.G19833.gnm2.ann1.Phvul.008G219600.1 orthology 0.205 3 129 2.65e-41
soybn_pan_p012238 orthology 0.316 3 - -
soybn_pan_p043843 orthology 0.23 3 131 4.87e-42