Gene cicar_pan_p009348
| Sequence ID | cicar_pan_p009348 add to my list | ||
|---|---|---|---|
| Species | Cicer arietinum | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 228aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 228 amino acids
>cicar_pan_p009348_CICAR MKRMDMFCSSPASTEVIHQSSIMLRRSRSTKSYYEHERRKNQLHRAPCSSQLLLPINPKP YFEKHRKSSADKQVNNDTRRKSSVHVKDLSSNYPSVADSSRRYLLDDKPFIDWVSESNKM VSKLDDKTMSMDMKRKDSHALVKFSSSPLSSKDQVVVLRVSLHCRACEGKVRKHISKMEG VTSFSIEMETKKVTIVGNVTPSSVLESVSKVKSAQLWSSPTLSSSYFT
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cicar_pan_p009348
Represented sequence(s):
CICAR_ICC_4958_desi
CICAR_CDC_Frontier_kabuli
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| FvH4_3g34750.1 | orthology | 0.814 | 3 | 164 | 2.72e-50 |
| Manes.04G029700.1 | orthology | 0.827 | 3 | - | - |
| Manes.11G135800.1 | orthology | 0.683 | 3 | 185 | 8.13e-59 |
| maldo_pan_p016590 | orthology | 0.849 | 3 | 179 | 4.49e-56 |
| maldo_pan_p031809 | orthology | 0.86 | 3 | - | - |
| medtr_pan_p012804 | orthology | 0.205 | 1 | 280 | 5.07e-95 |