Gene cicar_pan_p009659


Sequence ID cicar_pan_p009659  add to my list
Species Cicer arietinum
Alias No gene alias
Pangenome status Core (2/2)
Length 68aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 68 amino acids

>cicar_pan_p009659_CICAR
MSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVEPDTVLKTVSKTGKPTAFWEGE
APSEIKAQ


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cicar_pan_p009659



Represented sequence(s):
CICAR_ICC_4958_desi
cicar.ICC4958.gnm2.ann1.Ca_10039.1
CICAR_CDC_Frontier_kabuli
cicar.CDCFrontier.gnm1.ann1.Ca_08425.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
medtr_pan_p015003 orthology 0.0422 1 137 1.94e-44
thecc_pan_p006409 orthology 0.403 2 116 3.19e-36
vitvi_pan_p027163 orthology 0.501 3 - -
vitvi_pan_p043448 orthology 0.517 3 - -
vitvi_pan_p043537 orthology 0.501 3 115 8.13e-36