Gene cicar_pan_p021432
Sequence ID | cicar_pan_p021432 add to my list | ||
---|---|---|---|
Species | Cicer arietinum | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 264aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 264 amino acids
>cicar_pan_p021432_CICAR MHCDGCASKIIKHLHSIKGVETVKAESETGKVTVTGNVDPTKLRDNLAEKTKKNVELISP QPKKGKEKENKENESNKISDDKKTDDKKNKDKETVSTAVLKMSLHCQGCCDKIGKMVSKT KGVLEIAIDKEKETVTVKGTMDVKALVENLTEKFKRKVEIVPSKKDKEGGEGGEGGGGKK KNKNKGGGGGGGGGEGGANNDNNEGGEVKIIEYSVQPPFGHGNEYVRVEGYNYPQVYEEL LHMHMHSQPPQMFSDENPNACLIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cicar_pan_p021432
Represented sequence(s):
Unrepresented genome(s):
CICAR_CDC_Frontier_kabuli
CICAR_ICC_4958_desi
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT5G60800.2 | orthology | 0.801 | 3 | - | - |
brana_pan_p000516 | orthology | 0.901 | 4 | - | - |
brana_pan_p055950 | orthology | 0.861 | 4 | - | - |
brana_pan_p067841 | orthology | 0.865 | 4 | - | - |
braol_pan_p002717 | orthology | 1 | 4 | - | - |
braol_pan_p017567 | orthology | 0.901 | 4 | - | - |
braol_pan_p040048 | orthology | 0.861 | 4 | - | - |
brarr_pan_p004266 | orthology | 0.884 | 3 | - | - |
brarr_pan_p006703 | orthology | 0.868 | 4 | - | - |
brarr_pan_p008731 | orthology | 1 | 4 | - | - |
brarr_pan_p020733 | orthology | 1 | 4 | - | - |
medtr_pan_p013059 | orthology | 0.289 | 1 | 273 | 1.09e-91 |