Gene cicar_pan_p022803


Sequence ID cicar_pan_p022803  add to my list
Species Cicer arietinum
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 108aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 108 amino acids

>cicar_pan_p022803_CICAR
MHCNACERTVVKAISECKGVEKFITDMNKHMVVVTGRIDPKKVLKKLKKKTGKRVEILSN
KDEESKDESHESDSLVIVPPCMFENGCCIKTETLMMFSDENPNACAIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP345758 Unannotated cluster
4 GP467256 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cicar_pan_p022803



Represented sequence(s):
CICAR_CDC_Frontier_kabuli
cicar.CDCFrontier.gnm1.ann1.Ca_06813.1
Unrepresented genome(s):
CICAR_ICC_4958_desi


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G21490.1 orthology 1 9 94.4 3.03e-26
Ca_27_985.2 orthology 1 10 - -
Ca_34_139.2 orthology 1 10 - -
Ca_43_446.2 orthology 1 9 - -
Cc03_g02440 orthology 1 9 95.1 7.37e-27
Cg9g003840.1 orthology 0.658 4 119 3.74e-36
Cm135610.1 orthology 0.69 4 125 1.15e-38
Cs9g05250.1 orthology 0.573 3 122 2.21e-37
DCAR_030575 orthology 1 8 92 2.71e-25
FvH4_3g29750.1 orthology 0.764 5 129 5.84e-40
FvH4_4g16960.1 orthology 0.76 5 - -
HanXRQChr08g0226491 orthology 1 8 87.4 2.31e-23
MELO3C021374.2.1 orthology 0.886 6 111 5.21e-33
Manes.15G018700.1 orthology 0.921 7 109 2.72e-32
Solyc03g098650.2.1 orthology 1 8 95.5 9.96e-27
brana_pan_p026722 orthology 1 11 101 1.15e-28
braol_pan_p034893 orthology 1 10 97.1 4.83e-27
braol_pan_p054032 orthology 1 9 - -
brarr_pan_p010495 orthology 1 11 100 1.87e-28
cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 orthology 0.291 3 172 4.75e-57
cucsa_pan_p017292 orthology 0.92 6 104 1.8e-30
medtr_pan_p033077 orthology 0.192 1 176 8.68e-59
phavu.G19833.gnm2.ann1.Phvul.003G099700.1 orthology 0.36 4 169 8.35e-56
soybn_pan_p008694 orthology 0.299 4 152 2.79e-49
soybn_pan_p032351 orthology 0.334 4 - -
thecc_pan_p001371 orthology 0.721 6 119 4.45e-36
vitvi_pan_p022438 orthology 0.971 6 97.8 1.2e-27
vitvi_pan_p032656 orthology 0.961 6 - -