Gene cicar_pan_p024449
| Sequence ID | cicar_pan_p024449 add to my list | ||
|---|---|---|---|
| Species | Cicer arietinum | ||
| Alias | No gene alias | ||
| Pangenome status | Dispensable (1/2) | ||
| Length | 270aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 270 amino acids
>cicar_pan_p024449_CICAR MSEENKEEEKKEETKEEKKEEEKKEENKDEEPPEIVLKVDMHCEACARKVAKALKGFEGV EEVTADSKGSKVVVKGKAADPIKVLERLQKKSGKKVELISPLPKPPEDKKEEEIKPPQPE EKKDEAPAVVTIILKIRMHCEACAQVIQKRIRKIKGVESVETDLVNDQAIVKGVIEPEKL VDEVNRRTKKQASIVKEEEKKGEEKKEEEKKEEKKEGGEEKKEGEENNVEEDDNKTDIKR SEYWPSKYYVDYAYAPEIFSDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cicar_pan_p024449
Represented sequence(s):
Unrepresented genome(s):
CICAR_CDC_Frontier_kabuli
CICAR_ICC_4958_desi
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.522 | 6 | 231 | 2.65e-75 |
| Ca_32_762.1 | orthology | 0.586 | 6 | - | - |
| Ca_69_1.19 | orthology | 0.586 | 6 | - | - |
| Ca_78_26.1 | orthology | 0.522 | 6 | - | - |
| Ca_9_645.2 | orthology | 0.581 | 5 | - | - |
| Cc09_g00430 | orthology | 0.581 | 6 | 186 | 6.87e-59 |
| Cg2g046420.1 | orthology | 0.42 | 6 | 217 | 5.46e-71 |
| Cm145580.1 | orthology | 0.637 | 5 | - | - |
| Cm298860.1 | orthology | 0.426 | 5 | - | - |
| Cs2g01750.1 | orthology | 0.42 | 6 | 232 | 2.37e-76 |
| DCAR_002239 | orthology | 0.477 | 6 | 237 | 3.07e-78 |
| DCAR_030843 | orthology | 0.519 | 6 | - | - |
| FvH4_3g00420.1 | orthology | 0.384 | 6 | 259 | 7.68e-87 |
| HanXRQChr16g0515801 | orthology | 0.62 | 6 | 213 | 1.16e-68 |
| MELO3C008010.2.1 | orthology | 0.527 | 5 | 234 | 1.61e-76 |
| Manes.09G082500.1 | orthology | 0.574 | 5 | - | - |
| Manes.S022000.1 | orthology | 0.347 | 5 | 209 | 5.16e-68 |
| Oeu029318.1 | orthology | 0.402 | 5 | 249 | 2.41e-83 |
| Oeu057024.1 | orthology | 0.441 | 5 | - | - |
| PGSC0003DMP400023518 | orthology | 0.734 | 8 | - | - |
| PGSC0003DMP400026383 | orthology | 0.499 | 7 | 215 | 1.57e-69 |
| Solyc04g015030.2.1 | orthology | 0.507 | 7 | 217 | 3.78e-70 |
| Solyc11g012690.1.1 | orthology | 0.783 | 8 | - | - |
| capan_pan_p012494 | orthology | 0.636 | 6 | - | - |
| capan_pan_p018045 | orthology | 0.749 | 7 | - | - |
| cucsa_pan_p011686 | orthology | 0.515 | 5 | 222 | 5.07e-72 |
| ipotf_pan_p000797 | orthology | 0.521 | 7 | 225 | 1.77e-73 |
| itb01g10210.t2 | orthology | 0.527 | 7 | 224 | 7.69e-73 |
| maldo_pan_p012376 | orthology | 0.397 | 6 | - | - |
| maldo_pan_p020510 | orthology | 0.406 | 6 | 262 | 6.8e-88 |
| medtr_pan_p010658 | orthology | 0.106 | 1 | 293 | 4.2e-100 |
| thecc_pan_p018912 | orthology | 0.315 | 5 | 235 | 4.18e-77 |
| vitvi_pan_p012828 | orthology | 0.375 | 4 | 244 | 6.36e-81 |