Gene cocnu_pan_p007495


Sequence ID cocnu_pan_p007495  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Core (2/2)
Length 136aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 136 amino acids

>cocnu_pan_p007495_COCNU
MGRLGFDRVLDCFSLSISPNSCLCMNPMEEKDNVERNALIKSHAEEMLKLRDIVDGTKTL
AFHLEPKTVVLRVSMHCNGCARKVEKHISKMEGVTSFEVDLENKRVVVMGDVTPFEVLES
VSKVKFAELWVTRQPS


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cocnu_pan_p007495



Represented sequence(s):
COCNU_CATD
Cnu_05737-RA
COCNU_C3B02_v2.0
COCNU_HT001RO02_14PF00930.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr20434 orthology 0.629 4 173 5.78e-57
Mba01_g17650.1 orthology 0.401 4 - -
Mba08_g26390.1 orthology 0.427 4 213 1.55e-72
ORGLA01G0170900.1 orthology 1 5 - -
XP_008809019.1 orthology 0.11 2 253 5.52e-88
XP_010925099.1 orthology 0.0618 1 263 3.16e-92
bradi_pan_p042928 orthology 1 6 - -
maize_pan_p021681 orthology 1 6 - -
musac_pan_p002002 orthology 0.401 4 - -
musac_pan_p039784 orthology 0.445 4 209 1.15e-70
sorbi_pan_p016251 orthology 1 6 - -
tritu_pan_p003582 orthology 1 6 - -