Gene cocnu_pan_p020678


Sequence ID cocnu_pan_p020678  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Core (2/2)
Length 125aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 125 amino acids

>cocnu_pan_p020678_COCNU
MADWQIVPAGKHVEAQYVEMKVPLYSYGCEKKIKKALSHFRGIHSVNVDYHLQKVTVWGI
CNKYDVLATIRKKRREARFWDQMETEVKSKVAEEEADAEKAPRRATISMRKFRKSWKKLL
PLVLY


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP077751 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cocnu_pan_p020678



Represented sequence(s):
COCNU_CATD
Cnu_16084-RA
COCNU_C3B02_v2.0
COCNU_HT001RO02_10PF06520.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G093870.1 orthology 0.803 6 141 9.92e-45
Mba04_g24060.1 orthology 0.392 3 - -
Sspon.05G0023740-1B orthology 0.583 4 - -
Sspon.05G0023740-1P orthology 0.583 5 - -
Sspon.05G0023740-2D orthology 0.583 5 152 2.16e-48
XP_010934032.1 orthology 0.0312 1 239 3.18e-83
bradi_pan_p042306 orthology 0.831 5 142 1.17e-44
maize_pan_p011588 orthology 0.669 3 143 2.36e-45
musac_pan_p009117 orthology 0.407 3 - -
orysa_pan_p048607 orthology 0.761 4 - -
orysa_pan_p051674 orthology 1 4 - -
sorbi_pan_p001968 orthology 0.599 4 154 1.37e-49
tritu_pan_p012747 orthology 0.804 6 142 7.89e-45
tritu_pan_p017403 orthology 0.813 6 - -
tritu_pan_p047012 orthology 0.796 6 - -