Gene cocnu_pan_p020915
| Sequence ID | cocnu_pan_p020915 add to my list |
|---|---|
| Species | Cocos nucifera |
| Alias | No gene alias |
| Pangenome status | Core (2/2) |
| Length | 114aa |
Length: 114 amino acids
>cocnu_pan_p020915_COCNU MERQKVTVTGWVDQKKVLKAVRKTGRRAVLWPYPYGAENSTFTIQQYYHQQHPALATGPV SVTAAPSSSYNYYKHGYDDSRMHGYYHPSAHSAVVSERAGDIFSVDNPNNCSIM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
| 1. | 2. | 3. | |
|---|---|---|---|
| 1. COCNU_HT001RO02_06PF06160.2 | 0.00 | -0.00 | 16.85 |
| 2. COCNU_HT001RO02_06PF06160.1 | -0.00 | 0.00 | -0.00 |
| 3. Cnu_07556-RA | 16.85 | -0.00 | 0.00 |
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HORVU3Hr1G072940.2 | orthology | 0.659 | 6 | - | - |
| Mba03_g16740.1 | orthology | 0.248 | 5 | 147 | 2.06e-47 |
| ORGLA01G0256400.1 | orthology | 0.568 | 5 | - | - |
| Sspon.03G0031090-1B | orthology | 0.631 | 5 | - | - |
| Sspon.03G0031090-2C | orthology | 0.631 | 5 | - | - |
| XP_008813766.1 | orthology | 0.0826 | 2 | 218 | 1.03e-74 |
| XP_010920018.1 | orthology | 0.0363 | 1 | 228 | 1.19e-78 |
| bradi_pan_p002062 | orthology | 0.701 | 5 | - | - |
| musac_pan_p001588 | orthology | 0.268 | 5 | - | - |
| orysa_pan_p003551 | orthology | 0.561 | 5 | - | - |
| sorbi_pan_p007128 | orthology | 0.63 | 5 | - | - |
| tritu_pan_p029517 | orthology | 0.615 | 6 | - | - |