Gene cocnu_pan_p023665


Sequence ID cocnu_pan_p023665  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 146aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 146 amino acids

>cocnu_pan_p023665_COCNU
MTIVEMCVHMDCSGCESKIRKALLKLKGVDNVDIDMVQQKVTVTGYVDQKKVLKAVRKTG
RRAVLWPYPYNVEYRTYAQEYYHQHHPTPAYHLIFNSNPRSYNYYKHGYNDSDMHGYYQK
PTYSHIVDERARSIFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cocnu_pan_p023665



Represented sequence(s):
COCNU_CATD
Cnu_03976-RA
Unrepresented genome(s):
COCNU_C3B02_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba06_g14980.1 orthology 0.61 4 - -
Mba07_g12280.1 orthology 0.308 4 - -
Mba10_g22190.1 orthology 0.349 4 234 6.7e-81
XP_008812071.1 orthology 0.053 2 287 1.76e-101
XP_010915521.1 orthology 0.0396 1 292 1.94e-103
musac_pan_p012257 orthology 0.356 4 - -
musac_pan_p013615 orthology 0.5 4 - -
musac_pan_p015597 orthology 0.313 4 234 1.09e-80