GreenPhyl v5 - Gene cocnu_pan

Gene cocnu_pan_p024529

Sequence ID

cocnu_pan_p024529 ^{add to my list}

Species

Cocos nucifera

Alias

No gene alias

Pangenome status

Dispensable (1/2)

Length

141aa

Gene Ontology

biological_process	metal ion transport GO:0030001 - metal ion transport

Gene Sequence
Gene Classification
Domain Pattern
Pangene Composition
Homolog Predictions

141 amino acids

>cocnu_pan_p024529_COCNU
MKRRPLQASGQVQASSMAGLQIFPADKHVEAQYVEMKVPLYSYGCEKKVKKALSHIRGIH
SVHVDYQLQKVTIWGICNKDDVLATIRKKRREARFWDQMETEVKNKVAEEEADAENSPHP
AAVNAHKSRKSWKKLFPLVPY

Clustering Level	Family ID	Family Name
1	Heavy metal transport/detoxification protein superfamily GP000323	Heavy metal transport/detoxification protein superfamily
2	Heavy metal transport/detoxification group1 GP015397	Heavy metal transport/detoxification group1
3	GP342521	Unannotated cluster
4	GP077751	Unannotated cluster

This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.

ID	Name	Type
Heavy metal-associated domain, HMA IPR006121	Heavy metal-associated domain, HMA	Domain
Heavy metal-associated domain superfamily IPR036163	Heavy metal-associated domain superfamily	Homologous_superfamily

IPR006121 IPR036163

IPR domains for cocnu_pan_p024529

Represented sequence(s):

COCNU_CATD

Cnu_30037-RA

Unrepresented genome(s):

COCNU_C3B02_v2.0

	Homology			RBH
Similar Sequence ID	Type	Evolutionary distance	Node distance	score	e-value
HORVU2Hr1G093870.1	orthology	0.877	7	-	-
Mba04_g24060.1	orthology	0.465	4	181	2.65e-60
Sspon.05G0023740-1B	orthology	0.656	5	-	-
Sspon.05G0023740-1P	orthology	0.656	6	-	-
Sspon.05G0023740-2D	orthology	0.656	6	-	-
XP_008808278.1	orthology	0.154	2	224	3.58e-77
XP_010919018.1	orthology	0.116	1	229	8.01e-79
bradi_pan_p042306	orthology	0.904	6	-	-
maize_pan_p011588	orthology	0.743	4	-	-
musac_pan_p009117	orthology	0.48	4	180	1.19e-59
orysa_pan_p048607	orthology	0.835	5	151	2.8e-48
orysa_pan_p051674	orthology	1	5	-	-
sorbi_pan_p001968	orthology	0.673	5	-	-
tritu_pan_p012747	orthology	0.878	7	-	-
tritu_pan_p017403	orthology	0.886	7	-	-
tritu_pan_p047012	orthology	0.869	7	-	-