Gene cocnu_pan_p024954


Sequence ID cocnu_pan_p024954  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 64aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 64 amino acids

>cocnu_pan_p024954_COCNU
MASTEEGPEPLKYQTLTLKVSIHCEGCKKKVKKVLQSIEGKLCQFRIPLFFSVLEFSSPR
LGFY




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cocnu_pan_p024954



Represented sequence(s):
COCNU_CATD
Cnu_32730-RA
Unrepresented genome(s):
COCNU_C3B02_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU1Hr1G021620.2 orthology 0.887 2 - -
ORGLA05G0032900.1 orthology 0.852 2 - -
Sspon.07G0012960-1A orthology 0.668 3 - -
Sspon.07G0012960-2B orthology 0.672 3 - -
Sspon.07G0012960-3D orthology 0.671 3 - -
bradi_pan_p040477 orthology 0.903 1 - -
maize_pan_p020073 orthology 0.707 3 - -
orysa_pan_p025103 orthology 0.842 2 - -
sorbi_pan_p019648 orthology 0.642 2 - -
tritu_pan_p011605 orthology 0.882 2 - -
tritu_pan_p014010 orthology 0.893 2 - -