Gene cocnu_pan_p029011


Sequence ID cocnu_pan_p029011  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 87aa



Length: 87 amino acids

>cocnu_pan_p029011_COCNU
MGKGLISEDLFLFWTHSRVWSFCLVKRMGKEDSINFLKARGKVTVSGNVDPAILLKKLNK
AGKHAELWGSKGGKNDHLSDQLQKAAE




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


No IPR domain.




Represented sequence(s):
COCNU_CATD
Cnu_23855-RA
Unrepresented genome(s):
COCNU_C3B02_v2.0


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba08_g00430.1 orthology 0.497 3 - -
Mba08_g07910.1 orthology 0.576 3 - -
Mba11_g17720.1 orthology 0.63 3 - -
XP_010907378.1 orthology 0.116 1 - -
cocnu_pan_p028798 ultra-paralogy 0.0104 0 - -
musac_pan_p000711 orthology 0.481 3 - -
musac_pan_p017513 orthology 1 2 - -
musac_pan_p017535 orthology 0.629 3 - -
musac_pan_p026837 orthology 0.587 3 - -