Gene cocnu_pan_p029889


Sequence ID cocnu_pan_p029889  add to my list
Species Cocos nucifera
Alias No gene alias
Pangenome status Dispensable (1/2)
Length 110aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 110 amino acids

>cocnu_pan_p029889_COCNU
MKIVAKVDGIISISVDAEKNTVTIIGEADAWIIVKELRKAGKMVEIESVGPHKKEEKKDD
KKKDDKKKEEKKDEKECKPLPPCCNTCKSGPGGNYGNVVWIDDSNRCTIL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP241502 Unannotated cluster
3 GP344090 Unannotated cluster
4 GP502432 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cocnu_pan_p029889



Represented sequence(s):
COCNU_C3B02_v2.0
COCNU_HT001RO02_01PF23690.1
Unrepresented genome(s):
COCNU_CATD


Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
CgUng002530.2 orthology 1 4 - -
Cm060200.2 orthology 1 4 - -
MELO3C015336.2.1 orthology 1 5 - -
XP_019703834.1 orthology 0.128 1 135 3.22e-42
cajca.ICPL87119.gnm1.ann1.C.cajan_06806.1 orthology 1 5 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_06837.1 orthology 1 5 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_10208.1 orthology 1 4 - -
cicar_pan_p020684 orthology 1 4 - -
cucsa_pan_p005094 orthology 1 5 - -
medtr_pan_p026239 orthology 1 4 - -
orange1.1t04018.1 orthology 1 3 - -
phavu.G19833.gnm2.ann1.Phvul.006G093700.1 orthology 1 3 - -
phavu.G19833.gnm2.ann1.Phvul.007G181500.1 orthology 1 4 - -
soybn_pan_p003331 orthology 1 5 - -
soybn_pan_p012422 orthology 1 5 - -
soybn_pan_p013228 orthology 1 4 - -
soybn_pan_p013486 orthology 1 4 - -