Gene cocnu_pan_p030265
Sequence ID | cocnu_pan_p030265 add to my list | ||
---|---|---|---|
Species | Cocos nucifera | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 143aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 143 amino acids
>cocnu_pan_p030265_COCNU MGLPPLQSLRKGQMKAAIGKGFGLWVSICVKPWLPFDSLAVCLRSRKSCSYSEHILGFGS VKRMSQEVRKPKYVLRVGIYCDGCKKTVAKVLQKIKGVDKVNVDAEEWKVTVSGDVDPAI LIQTLKKKAGKHAELLEVGKQGA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cocnu_pan_p030265
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62005083-RA | orthology | 0.695 | 1 | - | - |
cocnu_pan_p031534 | ultra-paralogy | 0.331 | 0 | - | - |