Gene cocnu_pan_p035228
Sequence ID | cocnu_pan_p035228 add to my list | ||
---|---|---|---|
Species | Cocos nucifera | ||
Alias | No gene alias | ||
Pangenome status | Dispensable (1/2) | ||
Length | 103aa | ||
Gene Ontology |
![]()
|
Length: 103 amino acids
>cocnu_pan_p035228_COCNU MAELNRNYDSLIVLLLVENTDINDRLTIFGRHGAISQKELETVVLRVGMSCQGCVGAVKR VLGKMEGVESFDVDLKEQKCRWSVVNGHPEASPGIHKQWRKQC
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP239638 | Unannotated cluster |
3 | GP341755 | Unannotated cluster |
4 | GP463817 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.