Gene cocnu_pan_p035969
| Sequence ID | cocnu_pan_p035969 add to my list |
|---|---|
| Species | Cocos nucifera |
| Alias | No gene alias |
| Pangenome status | Dispensable (1/2) |
| Length | 289aa |
Length: 289 amino acids
>cocnu_pan_p035969_COCNU MKDGHKSNKDQGKQRLIQGLRAFKHQHNKLPPLSSDEEDYDDDDDEVKGLDELPFLDLNP INFLRQTSNAAAIAKKTCNGNAGGNGNGGAGKICGGNTYQSQINNIDISQQKGIDISANS KIINGVRLGGGNPNAGVINGVHLGGGNPNAGEIRRMNDINGMTMGLHGLGRNNVGGFQGN GFPGYARFPSNGEGFGGHRQSPMMVNMQGYQAHPSSMMNNLMGRNNNMIMHDSRYMQPQM MYHRSPQISPYTGYYPCYPNPYHPNNQSDDSDYGIHLFSDENTRGCVVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr15259 | orthology | 0.648 | 5 | - | - |
| HORVU3Hr1G004420.1 | orthology | 0.75 | 5 | - | - |
| Mba02_g23430.1 | orthology | 0.656 | 4 | - | - |
| Mba03_g01140.1 | orthology | 0.525 | 4 | - | - |
| Mba10_g22160.1 | orthology | 0.575 | 4 | - | - |
| ORGLA01G0014900.1 | orthology | 0.739 | 5 | - | - |
| Sspon.03G0019370-1A | orthology | 0.855 | 6 | - | - |
| Sspon.03G0019370-2C | orthology | 0.815 | 6 | 52.4 | 2.34e-07 |
| Sspon.03G0019370-3D | orthology | 0.8 | 6 | - | - |
| XP_010916342.1 | orthology | 0.0813 | 1 | - | - |
| XP_026656869.1 | orthology | 0.125 | 2 | - | - |
| bradi_pan_p041682 | orthology | 0.682 | 4 | - | - |
| cocnu_pan_p021838 | ultra-paralogy | 0.0011 | 0 | - | - |
| maize_pan_p016355 | orthology | 0.893 | 6 | - | - |
| maize_pan_p016830 | orthology | 0.854 | 6 | - | - |
| musac_pan_p029655 | orthology | 0.636 | 4 | - | - |
| musac_pan_p029948 | orthology | 0.571 | 4 | - | - |
| musac_pan_p030748 | orthology | 0.508 | 3 | - | - |
| musac_pan_p032325 | orthology | 0.507 | 4 | - | - |
| orysa_pan_p014393 | orthology | 0.739 | 5 | - | - |
| sorbi_pan_p026568 | orthology | 0.794 | 5 | - | - |
| tritu_pan_p033683 | orthology | 0.729 | 5 | - | - |
| tritu_pan_p038784 | orthology | 0.719 | 5 | - | - |
| tritu_pan_p048092 | orthology | 0.73 | 5 | - | - |