Gene cucsa_pan_p001819
| Sequence ID | cucsa_pan_p001819 add to my list | ||
|---|---|---|---|
| Species | Cucumis sativus | ||
| Alias | No gene alias | ||
| Pangenome status | Core (3/3) | ||
| Length | 151aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 151 amino acids
>cucsa_pan_p001819_CUCSA MGVGGTLEYLSDLVGNTHKHKKKKQLQTVELKVRMDCDGCELKVKNALSSLSGVKSVEIN RKQQKVTVTGYVEASKILKKAKSTGKKAEIWPYVPYSLVSQPYIAQAYDKKAPPGYVRNV EQTATTASVTKYEDPYINMFSDDNPNACSVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p001819
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cg1g028830.1 | orthology | 0.161 | 4 | 251 | 1.74e-87 |
| Cm206550.1 | orthology | 0.155 | 4 | 253 | 5.05e-88 |
| Cs1g01860.1 | orthology | 0.161 | 3 | 251 | 2.68e-87 |
| FvH4_1g21640.1 | orthology | 0.186 | 5 | 259 | 1.51e-90 |
| MELO3C007779.2.1 | orthology | 0.014 | 1 | 301 | 4.3e-107 |
| Manes.12G139000.1 | orthology | 0.156 | 4 | - | - |
| Manes.13G090400.1 | orthology | 0.183 | 4 | 264 | 1.87e-92 |
| maldo_pan_p008643 | orthology | 0.196 | 5 | 264 | 3.89e-92 |