Gene cucsa_pan_p001888
Sequence ID | cucsa_pan_p001888 add to my list | ||
---|---|---|---|
Species | Cucumis sativus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 360aa | ||
Gene Ontology |
![]()
|
Length: 360 amino acids
>cucsa_pan_p001888_CUCSA MGEKVEAAKNDGEKKAAADAGQKKDDGAVTAVFKIDMHCDGCAKKIKRVVKHLNGVSDVK ADPSSNKLTVTGKVDPAVIKTKLEQKTKKKVEIVSPQPKKEGGGDKKPDEKTEKKTDEKA EKKTDEKGEKKADGKSEKKADEKAEKKPEEKKTEEKKAKESTVVLKMRLHCEGCIQKIRR ALIKFKGTNEISVDAQKDLITVKGTIEGKDLQSYLKDKFNRSVEVIPPKKEEPAAGGEKK AKEAGGGGGEKKENDGKAAASSGGDGGSAKVVEVSKYEYSGFSYPPSVFYYDAPAHSHTH QYSQAMEAQPSYPIYGFANSSGYYANPNYVHQGYSTPMNDHSHASQMFSDENPNAYCSVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p001888
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
CgUng002500.1 | orthology | 0.547 | 7 | 206 | 5.48e-64 |
CgUng019980.1 | orthology | 0.547 | 7 | - | - |
Cm060230.1 | orthology | 0.549 | 5 | - | - |
FvH4_6g16410.1 | orthology | 0.635 | 3 | 216 | 8.37e-68 |
MELO3C024466.2.1 | orthology | 0.06 | 1 | 452 | 3.59e-160 |
Manes.08G010600.1 | orthology | 0.647 | 4 | 197 | 3.73e-60 |
Manes.09G066300.1 | orthology | 0.674 | 4 | - | - |
maldo_pan_p018618 | orthology | 0.601 | 3 | 219 | 1.88e-68 |
maldo_pan_p021518 | orthology | 0.615 | 3 | - | - |
orange1.1t00956.1 | orthology | 0.55 | 6 | - | - |