Gene cucsa_pan_p007395
| Sequence ID | cucsa_pan_p007395 add to my list |
|---|---|
| Species | Cucumis sativus |
| Alias | No gene alias |
| Pangenome status | Core (3/3) |
| Length | 132aa |
Length: 132 amino acids
>cucsa_pan_p007395_CUCSA MDSDDGSVRICGRVNPRTFLKVIEKSGKHAEVRSIRFDGEAGDRRYYPSFGDDASNHSSY SNPYQSYNEQSHWFDRCYPNLQRPQPYPWQLMLPQPQPQPVSWPMMWPGWPQPDNQFLDG NQNNFQRCCTVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP260139 | Unannotated cluster |
| 3 | GP373092 | Unannotated cluster |
| 4 | GP518118 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Represented sequence(s):
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| MELO3C014100.2.1 | orthology | 0.0744 | 1 | 233 | 4.15e-80 |