Gene cucsa_pan_p008172
Sequence ID | cucsa_pan_p008172 add to my list | ||
---|---|---|---|
Species | Cucumis sativus | ||
Alias | No gene alias | ||
Pangenome status | Core (3/3) | ||
Length | 154aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 154 amino acids
>cucsa_pan_p008172_CUCSA MGVLDHLSDYFDCSSHGHKHKKRKQLQTVELKIRIDCEGCERKVKRALEGMKGVKQVDVD RKANKATVVGYVEPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPAGYVRK ADDPNVYQLARASSTEVRYTTAFSDENPAACAVM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for cucsa_pan_p008172
Represented sequence(s):
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg8g001620.1 | orthology | 0.179 | 3 | 261 | 3.13e-91 |
Cm237380.1 | orthology | 0.198 | 4 | 257 | 1.76e-89 |
Cs8g02620.1 | orthology | 0.185 | 4 | 260 | 9.77e-91 |
MELO3C013353.2.1 | orthology | 0.0198 | 1 | 293 | 6.06e-104 |
Manes.04G076000.1 | orthology | 0.164 | 3 | 260 | 1.08e-90 |