Gene cucsa_pan_p017207


Sequence ID cucsa_pan_p017207  add to my list
Species Cucumis sativus
Alias No gene alias
Pangenome status Core (3/3)
Length 91aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 91 amino acids

>cucsa_pan_p017207_CUCSA
METVELKVEMVGIHEKRLRKCLSKLKGVEKVEVDANSQKVAVSSYIHRNKILKAIRRSGL
KADFWSAQNELLNAYATTYGAFRFSPYNSFF


Multiple alignment used to build consensus sequence:



Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for cucsa_pan_p017207



Represented sequence(s):
CUCSA_PI183967
evm.model.Chr4.2708
CUCSA_ASM407_v2.0
KGN55538
CUCSA_Gy14_v2.0
CsGy4G025530.1
Download sequences FASTA



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_12_32.9 orthology 0.46 11 - -
Ca_3_262.11 orthology 0.46 11 - -
Ca_455_136.3 orthology 0.46 11 - -
Ca_68_16.11 orthology 0.483 11 124 1.34e-38
Cc10_g00290 orthology 0.483 11 109 3.05e-33
Cg3g025710.1 orthology 0.27 7 142 6.16e-46
Cm122260.1 orthology 0.282 6 140 6e-45
Cs3g27690.1 orthology 0.27 7 142 6.7e-46
DCAR_023025 orthology 0.343 8 125 2.13e-39
HORVU7Hr1G051110.3 orthology 1 13 73.6 9.25e-19
MELO3C017056.2.1 orthology 0 1 178 2.32e-60
Manes.05G127500.1 orthology 0.307 3 137 4.84e-44
Manes.18G002200.1 orthology 0.32 3 - -
Mba08_g25790.1 orthology 0.69 11 114 8.39e-35
ORGLA08G0178600.1 orthology 0.787 12 102 4.46e-30
Oeu013567.1 orthology 0.364 9 125 1.64e-39
Sspon.06G0001840-1A orthology 0.995 11 - -
Sspon.06G0001840-2C orthology 0.807 11 104 2.32e-30
Sspon.06G0001840-3D orthology 0.817 11 - -
XP_010932092.1 orthology 0.497 10 - -
XP_017697769.1 orthology 0.521 10 119 8.85e-37
XP_019707878.1 orthology 0.534 11 120 2.31e-37
bradi_pan_p007471 orthology 0.798 12 107 8e-32
cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 orthology 0.475 7 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 orthology 0.473 7 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 orthology 0.471 6 133 1.51e-42
capan_pan_p037558 orthology 0.47 10 112 3.1e-34
cicar_pan_p012771 orthology 0.593 8 130 2.01e-41
cocnu_pan_p024788 orthology 0.497 10 116 6.74e-36
cocnu_pan_p029661 orthology 0.56 11 - -
maize_pan_p023740 orthology 0.79 11 104 6.72e-31
maldo_pan_p020708 orthology 0.305 5 129 1.65e-40
medtr_pan_p031498 orthology 0.525 8 134 5.89e-43
musac_pan_p036492 orthology 0.678 11 115 2.28e-35
orysa_pan_p046260 orthology 0.763 12 104 5.88e-31
phavu.G19833.gnm2.ann1.Phvul.002G208500.1 orthology 0.482 6 135 3.45e-43
sorbi_pan_p020199 orthology 0.765 11 107 3.34e-32
soybn_pan_p018879 orthology 0.525 6 137 6e-44
soybn_pan_p037728 orthology 0.55 7 - -
soybn_pan_p037999 orthology 0.591 7 - -
soybn_pan_p041984 orthology 0.56 7 - -
thecc_pan_p004256 orthology 0.286 2 126 8.42e-40
tritu_pan_p008810 orthology 0.803 13 99 9.41e-29
vitvi_pan_p014910 orthology 0.259 6 142 7.48e-46
vitvi_pan_p031077 orthology 0.259 6 - -