Gene evm_27.model.AmTr_v1.0_scaffold00018.18
Sequence ID | evm_27.model.AmTr_v1.0_scaffold00018.18 add to my list | ||
---|---|---|---|
Species | Amborella trichopoda | ||
Alias | No gene alias | ||
Length | 138aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 138 amino acids
>evm_27.model.AmTr_v1.0_scaffold00018.18_AMBTC MSNAMSIVELLVHMDCIGCEKKIRKAISKLEGVGSYEIDMDRQKVTVTGYINQRKVLKAV RRSGKKAEFWPYPYDGEYHPYTSQYMEESTYASTYNYYRHGYNHSVQGYFPDPVFSWVEV DNATSVFSDENVHACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.