Gene evm_27.model.AmTr_v1.0_scaffold00072.133
Sequence ID | evm_27.model.AmTr_v1.0_scaffold00072.133 add to my list | ||
---|---|---|---|
Species | Amborella trichopoda | ||
Alias | No gene alias | ||
Length | 285aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 285 amino acids
>evm_27.model.AmTr_v1.0_scaffold00072.133_AMBTC MGEAKDDGQKNKGEGKKEDGPTTVVLKVDMHCEGCARKVKRAVKNSEGVESVKADCSTNK LTVVGKVDPSKIRERVEEKTKKKVELLSPAPKKETGEKKPEEKTEKKVEEKKSKEPSVST VVLKIRLHCEGCIRKIRRIIKKIKGVQSVELDSQKDLVTVKGTMDVKALPIYLKEKLKRN VELVPPKKDEKPAEKPKEAEKPKEGGGGEKKEGGGGEKKEGGGGEKKEGGGEKKEGGGEA KKEDPSTKVVVNKMEYYGYGPGYSIEYVHAPQIFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP071484 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for evm_27.model.AmTr_v1.0_scaffold00072.133
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
MELO3C009355.2.1 | orthology | 0.479 | 3 | 183.3 | 1.8e-46 |
cucsa_pan_p007332 | orthology | 0.482 | 3 | 194 | 1.02e-59 |
thecc_pan_p007996 | orthology | 0.456 | 2 | 209 | 3.4e-66 |