Gene evm_27.model.AmTr_v1.0_scaffold00076.26
| Sequence ID | evm_27.model.AmTr_v1.0_scaffold00076.26 add to my list | ||
|---|---|---|---|
| Species | Amborella trichopoda | ||
| Alias | No gene alias | ||
| Length | 136aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 136 amino acids
>evm_27.model.AmTr_v1.0_scaffold00076.26_AMBTC MSVVEVLVKNMDCCGCTAKIEKALFRLKGVEAVEVDMEMHKVTVRGYSIEEKKIVKAINK TGKVAEPWPFPQYSSHVSSFYKFPSHVAEQYYDISQGTAAAHTFFHTPAAYSVALASDEA AASLFSDENPHACTIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for evm_27.model.AmTr_v1.0_scaffold00076.26
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.806 | 9 | 166 | 1.6e-41 |
| AUR62015981-RA | orthology | 0.759 | 8 | - | - |
| Bv3_055490_mxet.t1 | orthology | 0.792 | 8 | 185.7 | 1.9e-47 |
| Ca_8_1007.1 | orthology | 0.534 | 5 | 182.6 | 4.6e-46 |
| Cc02_g02970 | orthology | 0.534 | 5 | 179.1 | 1.7e-45 |
| Cg9g026790.1 | orthology | 0.606 | 9 | 187.6 | 5e-48 |
| Cm028340.1 | orthology | 0.606 | 9 | 187.6 | 8.5e-48 |
| Cs9g17280.1 | orthology | 0.606 | 9 | 187.6 | 5.5e-48 |
| DCAR_009368 | orthology | 0.483 | 3 | 185.7 | 2.3e-47 |
| FvH4_7g29520.1 | orthology | 0.646 | 10 | 192.2 | 2.1e-49 |
| HanXRQChr06g0183831 | orthology | 0.683 | 4 | 187.6 | 8.5e-48 |
| HanXRQChr09g0253621 | orthology | 0.71 | 4 | - | - |
| MELO3C003319.2.1 | orthology | 0.742 | 8 | 166.8 | 8.3e-42 |
| Manes.14G025900.1 | orthology | 0.679 | 10 | 180.3 | 9.6e-46 |
| Mba01_g04690.1 | orthology | 0.732 | 3 | 169.5 | 1.7e-42 |
| Oeu024220.1 | orthology | 0.422 | 2 | 192.2 | 3.3e-49 |
| PGSC0003DMP400025270 | orthology | 0.527 | 7 | 184.9 | 3.7e-47 |
| Solyc03g025790.2.1 | orthology | 0.517 | 7 | 186 | 1.6e-47 |
| brana_pan_p044950 | orthology | 0.779 | 10 | 169 | 4.72e-55 |
| braol_pan_p025375 | orthology | 0.779 | 11 | 169 | 4.56e-55 |
| brarr_pan_p005835 | orthology | 0.779 | 11 | 169 | 4.06e-55 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.655 | 11 | 184.1 | 6.6e-47 |
| capan_pan_p012989 | orthology | 0.54 | 6 | 187 | 2.93e-62 |
| cucsa_pan_p007884 | orthology | 0.709 | 8 | 169 | 5.91e-55 |
| ipotf_pan_p019855 | orthology | 0.539 | 6 | 180 | 1.11e-59 |
| ipotf_pan_p021461 | orthology | 0.711 | 6 | - | - |
| itb03g13280.t1 | orthology | 0.539 | 6 | 182.6 | 2e-46 |
| itb12g25750.t1 | orthology | 0.698 | 6 | - | - |
| maldo_pan_p005834 | orthology | 0.651 | 10 | 184 | 4.54e-61 |
| maldo_pan_p046866 | orthology | 1 | 10 | - | - |
| medtr_pan_p031372 | orthology | 0.638 | 9 | 176 | 8.45e-58 |
| musac_pan_p029616 | orthology | 0.719 | 3 | 168 | 8.87e-55 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.653 | 11 | 188.3 | 3.2e-48 |
| soybn_pan_p030070 | orthology | 0.629 | 10 | 164 | 2.7e-53 |
| thecc_pan_p002573 | orthology | 0.626 | 10 | 178 | 5.29e-59 |
| vitvi_pan_p028565 | orthology | 0.573 | 5 | 177 | 1.68e-58 |