Gene evm_27.model.AmTr_v1.0_scaffold00110.70
| Sequence ID | evm_27.model.AmTr_v1.0_scaffold00110.70 add to my list |
|---|---|
| Species | Amborella trichopoda |
| Alias | No gene alias |
| Length | 81aa |
Length: 81 amino acids
>evm_27.model.AmTr_v1.0_scaffold00110.70_AMBTC MTAKSIILAVVGSGVLGFALDYVISDKKLFGGTTPSTMTRPEWWEETDRKFQAWPRTAGP PVVMNPISRQNFIVKTPSPDA
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for evm_27.model.AmTr_v1.0_scaffold00110.70
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr01g0029661 | orthology | 0.744 | 1 | - | - |
| evm_27.model.AmTr_v1.0_scaffold00109.87 | ultra-paralogy | 0.209 | 0 | - | - |