Gene evm_27.model.AmTr_v1.0_scaffold00210.9
| Sequence ID | evm_27.model.AmTr_v1.0_scaffold00210.9 add to my list |
|---|---|
| Species | Amborella trichopoda |
| Alias | No gene alias |
| Length | 77aa |
Length: 77 amino acids
>evm_27.model.AmTr_v1.0_scaffold00210.9_AMBTC MANLTSRLLPGYALCLVPGIAKRPQTVAYGFRNRAKTLNMRSVSTIPQASASLAPIAPVK EVFLGTAKTSLSLAAIC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
| 2 | GP111951 | Unannotated cluster |
| 3 | GP122660 | Unannotated cluster |
| 4 | GP136687 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba10_g07270.1 | orthology | 1 | 4 | - | - |
| Oeu046999.1 | orthology | 1 | 3 | - | - |
| Sspon.02G0011600-1A | orthology | 1 | 1 | - | - |
| evm_27.model.AmTr_v1.0_scaffold00007.253 | ultra-paralogy | 0.107 | 0 | - | - |
| evm_27.model.AmTr_v1.0_scaffold00110.131 | ultra-paralogy | 0.134 | 0 | - | - |
| maldo_pan_p047466 | orthology | 1 | 3 | - | - |
| musac_pan_p038561 | orthology | 1 | 3 | - | - |