Gene ipotf_pan_p002253
Sequence ID | ipotf_pan_p002253 add to my list | ||
---|---|---|---|
Species | Ipomoea trifida | ||
Alias | No gene alias | ||
Pangenome status | Core (2/2) | ||
Length | 295aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 295 amino acids
>ipotf_pan_p002253_IPOTF MAASEPPPDEQPPPQFPPPLPYKTWVLKVSIHCQACKRKVKKVLQSIEGVYITDIDEKQH KVTVTGNVEADALIKKLIRSGKNAEMWHEKSSFKEKKSGNPNQRPEGAKSNENSDEDDDN NEEEDDGKAGENNVDGQKQKTGGPSVRFDVPPPGNAGGGGAPPKKKKKKKKKKSSGAAAP AGSNNAPPGNAGPETSRMGPPPLHGVDPGSLGHPYAPPAHQYPPSYGAPQQGYVVSYNAA PHPGGGGGGAPTYYYAPSSPYTYAYTRAEVHSMRCRPLDSFEILSDENPNACYIM
Multiple alignment used to build consensus sequence:
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p002253
Represented sequence(s):
1. | 2. | 3. | |
---|---|---|---|
1. itf01g28710.t2 | 0.00 | 2.06 | 12.49 |
2. Itr.Sc0000023.14 | 2.06 | 0.00 | 9.50 |
3. Itr.Sc0000023.13 | 12.49 | 9.50 | 0.00 |
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr03g0080771 | orthology | 0.768 | 2 | - | - |
HanXRQChr13g0411351 | orthology | 0.766 | 2 | 152 | 3.9e-44 |
itb01g28440.t1 | orthology | 0.0176 | 1 | 441 | 1.12e-157 |