Gene ipotf_pan_p003030
| Sequence ID | ipotf_pan_p003030 add to my list | ||
|---|---|---|---|
| Species | Ipomoea trifida | ||
| Alias | No gene alias | ||
| Pangenome status | Core (2/2) | ||
| Length | 148aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 148 amino acids
>ipotf_pan_p003030_IPOTF MYFGWFKKTRRSDALSIVELLVRMDCDGCQKRVRRAISKVEGVDSMEIDMDRQKVTVKGY VEGRRVLKAVRRGGSRAELWPFPDDGEYFPYAAQYLDESNFAPTYNYYTHGYNESMRGYY PTLPYSTLVDDNVTFSFSDDNVHACIVM
Multiple alignment used to build consensus sequence:
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ipotf_pan_p003030
Represented sequence(s):
IPOTF_NSP306
IPOTF_Y22
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G56891.1 | orthology | 1 | 8 | 138 | 1.22e-42 |
| Ca_28_123.1 | orthology | 0.653 | 5 | - | - |
| Ca_31_155.3 | orthology | 0.609 | 5 | - | - |
| Ca_64_676.1 | orthology | 0.57 | 5 | - | - |
| Ca_78_1273.1 | orthology | 0.609 | 5 | - | - |
| Cc06_g21060 | orthology | 0.524 | 5 | 115 | 6.34e-34 |
| Cg6g011520.1 | orthology | 0.674 | 11 | 194 | 6.48e-65 |
| Cs6g10930.1 | orthology | 0.668 | 11 | 186 | 2.03e-61 |
| DCAR_016949 | orthology | 0.545 | 3 | 134 | 1.62e-41 |
| FvH4_2g26780.1 | orthology | 0.675 | 9 | 134 | 5.19e-41 |
| MELO3C019416.2.1 | orthology | 0.753 | 11 | 176 | 8.03e-58 |
| Manes.08G099200.1 | orthology | 0.621 | 7 | 179 | 6.67e-59 |
| Oeu053981.1 | orthology | 0.421 | 2 | 167 | 1.37e-54 |
| brana_pan_p032952 | orthology | 1 | 9 | - | - |
| brana_pan_p033418 | orthology | 1 | 10 | - | - |
| brana_pan_p049288 | orthology | 1 | 8 | 140 | 3.39e-43 |
| braol_pan_p001934 | orthology | 1 | 9 | 139 | 6.18e-43 |
| braol_pan_p038031 | orthology | 1 | 9 | - | - |
| brarr_pan_p006813 | orthology | 1 | 10 | - | - |
| brarr_pan_p018750 | orthology | 1 | 8 | 140 | 1.88e-43 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 | orthology | 0.81 | 13 | 176 | 4.6e-58 |
| cucsa_pan_p011351 | orthology | 0.786 | 11 | 174 | 3.16e-57 |
| itb11g01700.t1 | orthology | 0.0136 | 1 | 305 | 7.1e-109 |
| maldo_pan_p024328 | orthology | 0.759 | 9 | - | - |
| maldo_pan_p038662 | orthology | 0.665 | 9 | 137 | 2.48e-42 |
| medtr_pan_p030129 | orthology | 0.761 | 11 | 139 | 2.01e-43 |
| phavu.G19833.gnm2.ann1.Phvul.004G052700.1 | orthology | 0.808 | 12 | 194 | 9.24e-65 |
| soybn_pan_p020075 | orthology | 0.827 | 13 | 143 | 4.19e-45 |
| thecc_pan_p019791 | orthology | 0.627 | 10 | 147 | 3.23e-46 |
| vitvi_pan_p003255 | orthology | 0.514 | 5 | 143 | 1.25e-44 |